CacheBy
Atlas Antibodies Anti-ADGRB2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ADGRB2 Antibody

상품 한눈에 보기

Human ADGRB2 단백질을 인식하는 고품질 폴리클로날 항체로, Rabbit에서 생산됨. Affinity purification 방식으로 정제되어 높은 특이성과 재현성을 제공. ICC 등 다양한 연구 응용에 적합하며, Human, Rat, Mouse 간 높은 교차 반응성 확인됨.

카탈로그번호
HPA069175-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA069175-100 Anti-ADGRB2 Antibody, adhesion G protein-coupled receptor B2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA069175-25 Anti-ADGRB2 Antibody, adhesion G protein-coupled receptor B2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ADGRB2 Antibody

Anti-ADGRB2 Antibody

Target Information

  • Target Protein: adhesion G protein-coupled receptor B2
  • Target Gene: ADGRB2
  • Alternative Gene Names: BAI2

면역세포화학(ICC)

Product Description

Polyclonal Antibody against Human ADGRB2

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

CLVGPEGSLSFSPLPGNILVPMAASPGLGEPPPPQEANPVYMCGEGGLRQLDLTWLRPTEPGSEGDYMVLPRRTLSL

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000014375 96%
Mouse ENSMUSG00000028782 94%

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.