CacheBy
Atlas Antibodies Anti-ADGRB2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ADGRB2 Antibody

상품 한눈에 보기

인간 ADGRB2 단백질을 인식하는 토끼 폴리클로날 항체입니다. 면역형광(ICC) 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 특이적이며, 쥐 및 생쥐와 높은 상동성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA054617-100 Anti-ADGRB2 Antibody, adhesion G protein-coupled receptor B2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054617-25 Anti-ADGRB2 Antibody, adhesion G protein-coupled receptor B2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ADGRB2 Antibody

Anti-ADGRB2 Antibody

Target Information

  • Target Protein: adhesion G protein-coupled receptor B2
  • Target Gene: ADGRB2
  • Alternative Gene Names: BAI2

Product Description

Polyclonal antibody against human ADGRB2.

Immunocytochemistry (ICC)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Antigen Sequence:
    CLVGPEGSLSFSPLPGNILVPMAASPGLGEPPPPQEANPVYMCGEGGLRQLDLTWLRPTEPGSEGDYMVLPRRTLSL

Species Reactivity

  • Verified Reactivity: Human
  • Interspecies Identity:
    • Rat (ENSRNOG00000014375): 96%
    • Mouse (ENSMUSG00000028782): 94%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.