
Atlas Antibodies Anti-ADAM12 Antibody
상품 한눈에 보기
인간 ADAM12 단백질을 인식하는 폴리클로날 항체로, IHC 정량 분석 및 RNA-seq 데이터와의 정합 검증에 적합. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨. Human에 반응하며, 안정한 PBS/glycerol 버퍼로 보존.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ADAM12 Antibody
Target Information
- Target Protein: ADAM metallopeptidase domain 12
- Target Gene: ADAM12
- Alternative Gene Names: MCMPMltna, MLTN
Product Description
Polyclonal antibody against human ADAM12.
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
RGVSLWNQGRADEVVSASVRSGDLWIPVKSFDSKNHPEVLNIRLQRESKELIINLERNEGLIASSFT
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000018384 | 55% |
| Mouse | ENSMUSG00000054555 | 55% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ADAM11 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ADAM12 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ADAM12 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ADAL Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ADAL Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.