Atlas Antibodies Anti-ACSL1 Antibody
Human ACSL1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Orthogonal 및 Independent validation을 통해 단백질 발현이 검증되었습니다. PrEST 항원을 이용해 친화 정제된 고품질 항체입니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ACSL1 Antibody
acyl-CoA synthetase long-chain family member 1
Recommended Applications
IHC (Orthogonal validation): 단백질 발현을 RNA-seq 데이터와 비교하여 고/저 발현 조직에서 검증
→ Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB (Independent validation): 서로 다른 epitope을 인식하는 독립 항체 간 단백질 발현 비교 검증
→ Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.ICC: 세포 수준에서 단백질 발현 확인
Product Description
Polyclonal Antibody against Human ACSL1
Alternative Gene Names
ACS1, FACL1, FACL2, LACS, LACS1, LACS2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | acyl-CoA synthetase long-chain family member 1 |
| Target Gene | ACSL1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | YATRPKPLKPPCDLSMQSVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSE |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000018796 (79%), Rat ENSRNOG00000010633 (76%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 맞는 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Atlas Antibodies
Atlas Antibodies Anti-ACSBG2 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-ACSL5 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-ACSL1 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-ACSL4 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-ACSBG2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|