Atlas Antibodies Anti-ACSL1 Antibody

상품 한눈에 보기

Human ACSL1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Orthogonal 및 Independent validation을 통해 단백질 발현이 검증되었습니다. PrEST 항원을 이용해 친화 정제된 고품질 항체입니다.

카탈로그번호: HPA011316-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA011316-100 Anti-ACSL1 Antibody, acyl-CoA synthetase long-chain family member 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA011316-25 Anti-ACSL1 Antibody, acyl-CoA synthetase long-chain family member 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-ACSL1 Antibody

Anti-ACSL1 Antibody

acyl-CoA synthetase long-chain family member 1

Recommended Applications

IHC (Orthogonal validation): 단백질 발현을 RNA-seq 데이터와 비교하여 고/저 발현 조직에서 검증
→ Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Independent validation): 서로 다른 epitope을 인식하는 독립 항체 간 단백질 발현 비교 검증
→ Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
ICC: 세포 수준에서 단백질 발현 확인

Product Description

Polyclonal Antibody against Human ACSL1

Alternative Gene Names

ACS1, FACL1, FACL2, LACS, LACS1, LACS2

Open Datasheet

Target Information

항목	내용
Target Protein	acyl-CoA synthetase long-chain family member 1
Target Gene	ACSL1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	YATRPKPLKPPCDLSMQSVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSE
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000018796 (79%), Rat ENSRNOG00000010633 (76%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet