CacheBy
Atlas Antibodies Anti-ACRV1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ACRV1 Antibody

상품 한눈에 보기

Human ACRV1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, RNA-seq 데이터 기반의 정교한 정합 검증을 거쳤습니다. 인간 시료에 최적화되어 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA038718-100 Anti-ACRV1 Antibody, acrosomal vesicle protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038718-25 Anti-ACRV1 Antibody, acrosomal vesicle protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ACRV1 Antibody

Anti-ACRV1 Antibody

Target: acrosomal vesicle protein 1 (ACRV1)
Type: Polyclonal Antibody against Human ACRV1


  • IHC (Orthogonal validation using RNA-seq data comparison for high and low expression tissues)
  • WB (Western Blot)

Product Description

Polyclonal antibody raised in rabbit against human ACRV1 (acrosomal vesicle protein 1).


Alternative Gene Names

D11S4365, SP-10, SPACA2

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein acrosomal vesicle protein 1
Target Gene ACRV1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence TSSQPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGSSEHGSSKHTVAEHTSGEHAE
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000008508 (63%), Mouse ENSMUSG00000032110 (60%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.