
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ACAT1 Antibody
상품 한눈에 보기
Human ACAT1 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC에 적합하며 유전적 및 독립 항체 검증 완료. 고순도 Affinity 정제 방식으로 제조되어 높은 특이성과 재현성을 제공. Human, Mouse, Rat 반응성 확인.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA004428-100 Anti-ACAT1 Antibody, acetyl-CoA acetyltransferase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA004428-25 Anti-ACAT1 Antibody, acetyl-CoA acetyltransferase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ACAT1 Antibody
Anti-ACAT1 Antibody
Target: acetyl-CoA acetyltransferase 1 (ACAT1)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry) – Validation of protein expression by comparing independent antibodies targeting different epitopes.
- WB (Western Blot) – Genetic validation by siRNA knockdown.
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human ACAT1.
Validated for multiple applications with enhanced validation methods ensuring specificity and reproducibility.
Alternative Gene Names
ACAT, THIL
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | acetyl-CoA acetyltransferase 1 |
| Target Gene | ACAT1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | VSATRTPIGSFLGSLSLLPATKLGSIAIQGAIEKAGIPKEEVKEAYMGNVLQGGEGQAPTRQAVLGAGLPISTPCTTINKVCASGMKAIMMASQSLMCGHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTD |
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information:
Highest antigen sequence identity to orthologs:
- Mouse (ENSMUSG00000032047) – 92%
- Rat (ENSRNOG00000007862) – 92%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



