CacheBy
Atlas Antibodies Anti-ACAT1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ACAT1 Antibody

상품 한눈에 보기

Human ACAT1 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC에 적합하며 유전적 및 독립 항체 검증 완료. 고순도 Affinity 정제 방식으로 제조되어 높은 특이성과 재현성을 제공. Human, Mouse, Rat 반응성 확인.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA004428-100 Anti-ACAT1 Antibody, acetyl-CoA acetyltransferase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA004428-25 Anti-ACAT1 Antibody, acetyl-CoA acetyltransferase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ACAT1 Antibody

Anti-ACAT1 Antibody

Target: acetyl-CoA acetyltransferase 1 (ACAT1)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry) – Validation of protein expression by comparing independent antibodies targeting different epitopes.
  • WB (Western Blot) – Genetic validation by siRNA knockdown.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human ACAT1.
Validated for multiple applications with enhanced validation methods ensuring specificity and reproducibility.


Alternative Gene Names

ACAT, THIL


Target Information

항목 내용
Target Protein acetyl-CoA acetyltransferase 1
Target Gene ACAT1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence VSATRTPIGSFLGSLSLLPATKLGSIAIQGAIEKAGIPKEEVKEAYMGNVLQGGEGQAPTRQAVLGAGLPISTPCTTINKVCASGMKAIMMASQSLMCGHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTD

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information:
Highest antigen sequence identity to orthologs:

  • Mouse (ENSMUSG00000032047) – 92%
  • Rat (ENSRNOG00000007862) – 92%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet


제품 이미지

Enhanced Validation
IHC Independent Validation
WB Genetic Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.