Atlas Antibodies Anti-ACAT1 Antibody
상품 한눈에 보기
Human ACAT1 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC에 적합하며 유전적 및 독립 항체 검증 완료. 고순도 Affinity 정제 방식으로 제조되어 높은 특이성과 재현성을 제공. Human, Mouse, Rat 반응성 확인.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ACAT1 Antibody
Target: acetyl-CoA acetyltransferase 1 (ACAT1)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry) – Validation of protein expression by comparing independent antibodies targeting different epitopes.
- WB (Western Blot) – Genetic validation by siRNA knockdown.
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human ACAT1.
Validated for multiple applications with enhanced validation methods ensuring specificity and reproducibility.
Alternative Gene Names
ACAT, THIL
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | acetyl-CoA acetyltransferase 1 |
| Target Gene | ACAT1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | VSATRTPIGSFLGSLSLLPATKLGSIAIQGAIEKAGIPKEEVKEAYMGNVLQGGEGQAPTRQAVLGAGLPISTPCTTINKVCASGMKAIMMASQSLMCGHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTD |
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information:
Highest antigen sequence identity to orthologs:
- Mouse (ENSMUSG00000032047) – 92%
- Rat (ENSRNOG00000007862) – 92%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Atlas Antibodies
Atlas Antibodies Anti-ACBD5 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-ACBD3 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-ACAT1 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-ACAP3 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-ACAT1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.