
Atlas Antibodies Anti-ACAA2 Antibody
상품 한눈에 보기
Human ACAA2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 정제된 PrEST 항원을 사용하여 높은 특이성과 재현성을 제공합니다. 사람, 마우스, 랫트에 반응하며, 정제된 IgG 형태로 제공됩니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ACAA2 Antibody
Target: acetyl-CoA acyltransferase 2 (ACAA2)
Type: Polyclonal Antibody against Human ACAA2
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation using RNA-seq comparison in high and low expression tissues)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Alternative Gene Names
- DSAEC
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | acetyl-CoA acyltransferase 2 |
| Target Gene | ACAA2 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | LLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETVDSVIMGNVLQSSSDAIYLARHVGLRVGIPKETPALTINRLCGSGFQSIVNGCQEICVKEAEVVLCGGTESMSQAPYCVRNVRFGTKLGSDIKLEDSLW |
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000036880 (86%)
- Rat ENSRNOG00000013766 (86%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide |
| Preservative MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ACACA Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ACAA1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ACAA2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-AC004381.6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ABTB2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.