CacheBy
Atlas Antibodies Anti-ACAA2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ACAA2 Antibody

상품 한눈에 보기

Human ACAA2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 정제된 PrEST 항원을 사용하여 높은 특이성과 재현성을 제공합니다. 사람, 마우스, 랫트에 반응하며, 정제된 IgG 형태로 제공됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA042303-100 Anti-ACAA2 Antibody, acetyl-CoA acyltransferase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042303-25 Anti-ACAA2 Antibody, acetyl-CoA acyltransferase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ACAA2 Antibody

Anti-ACAA2 Antibody

Target: acetyl-CoA acyltransferase 2 (ACAA2)
Type: Polyclonal Antibody against Human ACAA2
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation using RNA-seq comparison in high and low expression tissues)
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.


Alternative Gene Names

  • DSAEC

Target Information

항목 내용
Target Protein acetyl-CoA acyltransferase 2
Target Gene ACAA2
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence LLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETVDSVIMGNVLQSSSDAIYLARHVGLRVGIPKETPALTINRLCGSGFQSIVNGCQEICVKEAEVVLCGGTESMSQAPYCVRNVRFGTKLGSDIKLEDSLW

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000036880 (86%)
  • Rat ENSRNOG00000013766 (86%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide
Preservative MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.