
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ABHD8 Antibody
상품 한눈에 보기
Human ABHD8 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB(재조합 발현) 검증 완료. 고순도 친화 정제 방식으로 제조되었으며, 다양한 종 간 높은 항원 서열 유사성을 가짐. 연구용으로 안정한 보관이 가능함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA037658-100 Anti-ABHD8 Antibody, abhydrolase domain containing 8 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037658-25 Anti-ABHD8 Antibody, abhydrolase domain containing 8 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ABHD8 Antibody
Anti-ABHD8 Antibody
abhydrolase domain containing 8
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against Human ABHD8.
Alternative Gene Names
FLJ11743, MGC14280, MGC2512
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | abhydrolase domain containing 8 |
| Target Gene | ABHD8 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | RQGAKEKQLLKEGNAFNVSSFVLRAMMSGQYWPEGDEVYHAELTVPVLLVHGMHDKFVPVEEDQRMAEILLLAFLKLIDEGSHMVMLECPETV |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000000054 (99%)
- Mouse ENSMUSG00000007950 (99%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



