CacheBy
Atlas Antibodies Anti-ABHD8 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ABHD8 Antibody

상품 한눈에 보기

Human ABHD8 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB(재조합 발현) 검증 완료. 고순도 친화 정제 방식으로 제조되었으며, 다양한 종 간 높은 항원 서열 유사성을 가짐. 연구용으로 안정한 보관이 가능함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA037658-100 Anti-ABHD8 Antibody, abhydrolase domain containing 8 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037658-25 Anti-ABHD8 Antibody, abhydrolase domain containing 8 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ABHD8 Antibody

Anti-ABHD8 Antibody

abhydrolase domain containing 8

  • Immunohistochemistry (IHC)
  • Western Blot (WB, Recombinant Expression Validation)
    Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal antibody against Human ABHD8.

Alternative Gene Names

FLJ11743, MGC14280, MGC2512

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein abhydrolase domain containing 8
Target Gene ABHD8
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence RQGAKEKQLLKEGNAFNVSSFVLRAMMSGQYWPEGDEVYHAELTVPVLLVHGMHDKFVPVEEDQRMAEILLLAFLKLIDEGSHMVMLECPETV

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000000054 (99%)
  • Mouse ENSMUSG00000007950 (99%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.