Atlas Antibodies Anti-ABHD17A Antibody
상품 옵션 정보 | ||||||
---|---|---|---|---|---|---|
카탈로그 번호 | 설명 | 상태 | 단위 | 가격 | 가격(VAT포함) | 수량 / 장바구니 |
HPA043270-100 | Atlas Antibodies HPA043270-100 Anti-ABHD17A Antibody, abhydrolase domain containing 17A 100ul | 재고문의 | 100ul | 728,000원 | 800,800원 | |
HPA043270-25 | Atlas Antibodies HPA043270-25 Anti-ABHD17A Antibody, abhydrolase domain containing 17A 25ul | 재고문의 | 25ul | 528,000원 | 580,800원 |
다른 상품 둘러보기
Anti-ABHD17A Antibody
abhydrolase domain containing 17A
Recommended Applications
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human ABHD17A
Alternative Gene Names
C19orf27, FAM108A1, MGC5244
Target Protein
abhydrolase domain containing 17A
Target Gene
ABHD17A
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
LDTIEVFPTKSARGNRVSCMYVRCVPGARY
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Mouse ENSMUSG00000003346 (87%)
Rat ENSRNOG00000018212 (87%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet
)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|