
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ABCF2 Antibody
상품 한눈에 보기
Human ABCF2 단백질을 인식하는 고특이성 Rabbit Polyclonal 항체. IHC, WB, ICC 등 다양한 응용에 적합. Orthogonal 및 Independent validation으로 검증된 신뢰성 높은 항체. PrEST 항원을 이용한 Affinity purification으로 높은 순도 보장.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA020091-100 Anti-ABCF2 Antibody, ATP-binding cassette, sub-family F (GCN20), member 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA020091-25 Anti-ABCF2 Antibody, ATP-binding cassette, sub-family F (GCN20), member 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ABCF2 Antibody
Anti-ABCF2 Antibody
ATP-binding cassette, sub-family F (GCN20), member 2
Recommended Applications
Orthogonal validation (IHC)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.Independent validation (WB)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.ICC (Immunocytochemistry)
Suitable for ICC applications.
Product Description
Polyclonal Antibody against Human ABCF2
Alternative Gene Names
ABC28, EST133090, HUSSY-18, M-ABC1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ATP-binding cassette, sub-family F (GCN20), member 2 |
| Target Gene | ABCF2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Information | Rat ENSRNOG00000010609 (97%), Mouse ENSMUSG00000028953 (93%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Antigen Sequence
KEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKSNotes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



