
Atlas Antibodies Anti-ABCF2 Antibody
Human ABCF2 단백질을 인식하는 고특이성 Rabbit Polyclonal 항체. IHC, WB, ICC 등 다양한 응용에 적합. Orthogonal 및 Independent validation으로 검증된 신뢰성 높은 항체. PrEST 항원을 이용한 Affinity purification으로 높은 순도 보장.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ABCF2 Antibody
ATP-binding cassette, sub-family F (GCN20), member 2
Recommended Applications
Orthogonal validation (IHC)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.Independent validation (WB)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.ICC (Immunocytochemistry)
Suitable for ICC applications.
Product Description
Polyclonal Antibody against Human ABCF2
Alternative Gene Names
ABC28, EST133090, HUSSY-18, M-ABC1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ATP-binding cassette, sub-family F (GCN20), member 2 |
| Target Gene | ABCF2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Information | Rat ENSRNOG00000010609 (97%), Mouse ENSMUSG00000028953 (93%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Antigen Sequence
KEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKSNotes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ABCF2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ABCF1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ABCF2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ABCD4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ABCD3 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|