
Atlas Antibodies Anti-ABCA3 Antibody
상품 한눈에 보기
인간 ABCA3 단백질을 인식하는 고품질 폴리클로날 항체. IHC 및 ICC 등 다양한 응용에 적합. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증 완료. 친화 정제 방식으로 높은 특이성과 재현성 보장.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ABCA3 Antibody
ATP-binding cassette, sub-family A (ABC1), member 3
Recommended Applications
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human ABCA3
Alternative Gene Names
ABC-C, ABC3, EST111653, LBM180
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ATP-binding cassette, sub-family A (ABC1), member 3 |
| Target Gene | ABCA3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000050057 (85%), Mouse ENSMUSG00000024130 (82%) |
Clonality / Isotype / Host
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Antigen Sequence
MLRLTLGEYGRTVVPFSVPGTSQLGQQLSEHLKDALQAEGQEPREVLGDLEEFLIFRASVEGGGFNERCLVAASFRDVGERTVVNALFNNQAYHSPATALAVVDNLLFKLLCGPHASIVVSNFPQPRSALQAAKDQFNEG제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ABCA6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ABCA7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ABCA3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ABCA5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ABCA5 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.