
원본
Atlas Antibodies Anti-A1CF Antibody
상품 한눈에 보기
Human A1CF 단백질을 인식하는 폴리클로날 래빗 항체로, IHC 및 WB에 적합. PrEST 항원을 이용해 친화 정제됨. 인간 종에 반응하며, 마우스·랫에서 높은 서열 동일성. 40% glycerol/PBS 버퍼에 sodium azide 보존제 포함.
- 카탈로그번호
- HPA044079-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA044079-100 Anti-A1CF Antibody, APOBEC1 complementation factor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044079-25 Anti-A1CF Antibody, APOBEC1 complementation factor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-A1CF Antibody
Anti-A1CF Antibody
Target: APOBEC1 complementation factor (A1CF)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
- WB (Western Blot)
Product Description
Polyclonal Antibody against Human A1CF
Alternative Gene Names
ACF, ACF64, ACF65, APOBEC1CF, ASP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | APOBEC1 complementation factor |
| Target Gene | A1CF |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | GQPVYQLHSAIGQDQRQLFLYKITIPALASQNPAIHPFTPPKLSAFVDEAKTYAAEYTLQTLGIPTDGGDGTMATAA |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (88%), Mouse (87%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



