Atlas Antibodies Anti-A1CF Antibody
상품 한눈에 보기
Human A1CF 단백질을 인식하는 폴리클로날 래빗 항체로, IHC 및 WB에 적합. PrEST 항원을 이용해 친화 정제됨. 인간 종에 반응하며, 마우스·랫에서 높은 서열 동일성. 40% glycerol/PBS 버퍼에 sodium azide 보존제 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-A1CF Antibody
Target: APOBEC1 complementation factor (A1CF)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
- WB (Western Blot)
Product Description
Polyclonal Antibody against Human A1CF
Alternative Gene Names
ACF, ACF64, ACF65, APOBEC1CF, ASP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | APOBEC1 complementation factor |
| Target Gene | A1CF |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | GQPVYQLHSAIGQDQRQLFLYKITIPALASQNPAIHPFTPPKLSAFVDEAKTYAAEYTLQTLGIPTDGGDGTMATAA |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (88%), Mouse (87%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.