CacheBy
Thermo Fisher Scientific SRP19 Polyclonal Antibody
원본

Thermo Fisher Scientific SRP19 Polyclonal Antibody

상품 한눈에 보기

SRP19 단백질을 인식하는 Thermo Fisher Scientific의 폴리클로날 항체로, Western blot, IHC, ELISA 등에 사용 가능. 인간, 마우스, 랫트 반응성. 친화 크로마토그래피 정제, PBS/glycerol buffer에 보관. 연구용 전용 제품.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 01. 오후 06:51
Thermo Fisher Scientific PA593197 SRP19 Polyclonal Antibody 100 ul pk판매 단위 pk ·
재고 확인 필요
618,800원VAT 포함 680,680원

Thermo Fisher Scientific · Thermo Fisher Scientific SRP19 Polyclonal Antibody

Applications and Tested Dilutions

Application Tested Dilution
Western Blot (WB) 1:500–1:2,000
Immunohistochemistry (Paraffin) (IHC (P)) 1:50–1:200
ELISA 1 µg/mL

Product Specifications

항목 내용
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen Recombinant fusion protein containing amino acids 1–144 of human SRP19 (NP_003126.1)
Conjugate Unconjugated
Form Liquid
Concentration 0.25 mg/mL
Purification Affinity Chromatography
Storage Buffer PBS, pH 7.3, with 50% glycerol
Contains 0.02% sodium azide
Storage Conditions -20°C, Avoid Freeze/Thaw Cycles
Shipping Conditions Wet ice
RRID AB_2806665

Product Specific Information

  • Immunogen sequence:
    MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKKKK
  • Positive Samples: HepG2, MCF7
  • Cellular Location: Cytoplasm

Target Information

SRP19 단백질은 SRP19 패밀리에 속하며, signal-recognition-particle(SRP) 복합체의 조립에 관여합니다. 7S RNA에 직접 결합하여 SRP의 54 kDa 서브유닛 결합을 매개합니다.


For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.