원본
Thermo Fisher Scientific SCTR Polyclonal Antibody
상품 한눈에 보기
SCTR 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot에 적합합니다. Human과 Rat 시료에 반응하며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도로 사용 가능합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 01. 오전 05:26
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA579960 SCTR Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific SCTR Polyclonal Antibody
Applications
- Western Blot (WB): 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human SCTR (398–440 aa, EVQKKWQQWHLREFPLHPVASFSNSTKASHLEQSQGTCRTSII) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747075 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The protein encoded by this gene is a G protein-coupled receptor and belongs to the glucagon-VIP-secretin receptor family. It binds secretin, which is the most potent regulator of pancreatic bicarbonate, electrolyte, and volume secretion. Secretin and its receptor are suggested to be involved in pancreatic cancer and autism.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific SDHA Polyclonal Antibody514,100원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific Syndecan 3 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific Uteroglobin Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific SCRIB Polyclonal Antibody568,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.