
Thermo Fisher Scientific SCTR Polyclonal Antibody
SCTR 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot에 적합합니다. Human과 Rat 시료에 반응하며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도로 사용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
- Western Blot (WB): 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human SCTR (398–440 aa, EVQKKWQQWHLREFPLHPVASFSNSTKASHLEQSQGTCRTSII) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747075 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The protein encoded by this gene is a G protein-coupled receptor and belongs to the glucagon-VIP-secretin receptor family. It binds secretin, which is the most potent regulator of pancreatic bicarbonate, electrolyte, and volume secretion. Secretin and its receptor are suggested to be involved in pancreatic cancer and autism.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific SDHA Polyclonal Antibody
514,100원

Thermo Fisher Scientific
Thermo Fisher Scientific Syndecan 3 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific SCTR Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific Uteroglobin Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific SCRIB Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|