Thermo Fisher Scientific WRCH1 Polyclonal Antibody
Thermo Fisher Scientific WRCH1 Polyclonal Antibody는 Mouse 시료에 반응하며 Rabbit IgG로 제작된 액상 항체입니다. Western blot에 1.0 µg/mL로 사용 가능하며, PBS buffer에 2% sucrose와 sodium azide를 포함합니다. -20°C 보관, 연구용으로 적합합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific WRCH1 Polyclonal Antibody
Applications
- Western Blot (WB): Tested at 1.0 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide directed towards the sequence YECKECGKAFSSGSNFTQHQRIHTGEKPYECKECGNAFSQSSQLIKHQRI (aa 41–90) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5 mg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | PBS with 2% sucrose |
| Contains | 0.09% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2689713 |
Product Specific Information
This target displays homology in the following species:
- Cow: 100%
- Dog: 100%
- Horse: 79%
- Human: 100%
- Mouse: 100%
- Pig: 79%
- Rabbit: 100%
- Rat: 79%
- Zebrafish: 93%
Target Information
This gene encodes a member of the Rho family of GTPases. This protein can activate PAK1 and JNK1, and can induce filopodium formation and stress fiber dissolution. It may also mediate the effects of WNT1 signaling in the regulation of cell morphology, cytoskeletal organization, and cell proliferation.
A non-coding transcript variant of this gene results from naturally occurring read-through transcription between this locus and the neighboring DUSP5P (dual specificity phosphatase 5 pseudogene) locus.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.