Thermo Fisher Scientific WRCH1 Polyclonal Antibody
Thermo Fisher Scientific WRCH1 Polyclonal Antibody는 Mouse 시료에 반응하며 Rabbit IgG로 제작된 액상 항체입니다. Western blot에 1.0 µg/mL로 사용 가능하며, PBS buffer에 2% sucrose와 sodium azide를 포함합니다. -20°C 보관, 연구용으로 적합합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
- Western Blot (WB): Tested at 1.0 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide directed towards the sequence YECKECGKAFSSGSNFTQHQRIHTGEKPYECKECGNAFSQSSQLIKHQRI (aa 41–90) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5 mg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | PBS with 2% sucrose |
| Contains | 0.09% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2689713 |
Product Specific Information
This target displays homology in the following species:
- Cow: 100%
- Dog: 100%
- Horse: 79%
- Human: 100%
- Mouse: 100%
- Pig: 79%
- Rabbit: 100%
- Rat: 79%
- Zebrafish: 93%
Target Information
This gene encodes a member of the Rho family of GTPases. This protein can activate PAK1 and JNK1, and can induce filopodium formation and stress fiber dissolution. It may also mediate the effects of WNT1 signaling in the regulation of cell morphology, cytoskeletal organization, and cell proliferation.
A non-coding transcript variant of this gene results from naturally occurring read-through transcription between this locus and the neighboring DUSP5P (dual specificity phosphatase 5 pseudogene) locus.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific WDR8 Polyclonal Antibody
642,300원
Thermo Fisher Scientific
Thermo Fisher Scientific WDR8 Polyclonal Antibody
642,300원
Thermo Fisher Scientific
Thermo Fisher Scientific WRCH1 Polyclonal Antibody
642,300원
Thermo Fisher Scientific
Thermo Fisher Scientific RBPMS2 Polyclonal Antibody
642,300원
Thermo Fisher Scientific
Thermo Fisher Scientific WRCH1 Polyclonal Antibody
642,300원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|