CacheBy
Thermo Fisher Scientific WRCH1 Polyclonal Antibody
원본

Thermo Fisher Scientific WRCH1 Polyclonal Antibody

상품 한눈에 보기

Thermo Fisher Scientific WRCH1 Polyclonal Antibody는 Mouse 시료에 반응하며 Rabbit IgG로 제작된 액상 항체입니다. Western blot에 1.0 µg/mL로 사용 가능하며, PBS buffer에 2% sucrose와 sodium azide를 포함합니다. -20°C 보관, 연구용으로 적합합니다.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오후 06:59
Thermo Fisher Scientific PA569127 WRCH1 Polyclonal Antibody 100 ul pk판매 단위 pk ·
재고 확인 필요
642,300원VAT 포함 706,530원

Thermo Fisher Scientific · Thermo Fisher Scientific WRCH1 Polyclonal Antibody

Applications

  • Western Blot (WB): Tested at 1.0 µg/mL

Product Specifications

항목 내용
Species Reactivity Mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen Synthetic peptide directed towards the sequence YECKECGKAFSSGSNFTQHQRIHTGEKPYECKECGNAFSQSSQLIKHQRI (aa 41–90)
Conjugate Unconjugated
Form Liquid
Concentration 0.5 mg/mL
Purification Affinity chromatography
Storage Buffer PBS with 2% sucrose
Contains 0.09% sodium azide
Storage Conditions -20°C, Avoid Freeze/Thaw Cycles
Shipping Conditions Wet ice
RRID AB_2689713

Product Specific Information

This target displays homology in the following species:

  • Cow: 100%
  • Dog: 100%
  • Horse: 79%
  • Human: 100%
  • Mouse: 100%
  • Pig: 79%
  • Rabbit: 100%
  • Rat: 79%
  • Zebrafish: 93%

Target Information

This gene encodes a member of the Rho family of GTPases. This protein can activate PAK1 and JNK1, and can induce filopodium formation and stress fiber dissolution. It may also mediate the effects of WNT1 signaling in the regulation of cell morphology, cytoskeletal organization, and cell proliferation.
A non-coding transcript variant of this gene results from naturally occurring read-through transcription between this locus and the neighboring DUSP5P (dual specificity phosphatase 5 pseudogene) locus.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.