
Atlas Antibodies Anti-LAGE3 Antibody
인간 LAGE3 단백질을 인식하는 폴리클로날 항체. IHC 및 ICC 응용에 적합. 토끼에서 생산된 IgG 항체로, PrEST 항원으로 친화 정제됨. 인간 반응성 검증 완료, 40% 글리세롤 PBS 버퍼 포함.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-LAGE3 Antibody
Target Information
- Target Protein: L antigen family, member 3
- Target Gene: LAGE3
- Alternative Gene Names: CVG5, DXS9879E, DXS9951E, ESO3, ITBA2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
IFTLSVPFPTPLEAEIAHGSLAPDAEPHQRVVGKDLTVSGRILVVRWKAEDCRLLRISVINFLDQLSLVVRTMQRFG
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000015289 | 71% |
| Rat | ENSRNOG00000053456 | 71% |
Product Description
Polyclonal Antibody against Human LAGE3
Clonality and Host
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-LAMB1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LAMC3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LAGE3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LAMA4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LAMA5 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|