CacheBy
Atlas Antibodies Anti-LAGE3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LAGE3 Antibody

상품 한눈에 보기

인간 LAGE3 단백질을 인식하는 폴리클로날 항체. IHC 및 ICC 응용에 적합. 토끼에서 생산된 IgG 항체로, PrEST 항원으로 친화 정제됨. 인간 반응성 검증 완료, 40% 글리세롤 PBS 버퍼 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036123-100 Anti-LAGE3 Antibody, L antigen family, member 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036123-25 Anti-LAGE3 Antibody, L antigen family, member 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LAGE3 Antibody

Anti-LAGE3 Antibody

Target Information

  • Target Protein: L antigen family, member 3
  • Target Gene: LAGE3
  • Alternative Gene Names: CVG5, DXS9879E, DXS9951E, ESO3, ITBA2

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
IFTLSVPFPTPLEAEIAHGSLAPDAEPHQRVVGKDLTVSGRILVVRWKAEDCRLLRISVINFLDQLSLVVRTMQRFG

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000015289 71%
Rat ENSRNOG00000053456 71%

Product Description

Polyclonal Antibody against Human LAGE3

Clonality and Host

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Material Safety Data Sheet

Purification Method

Affinity purified using the PrEST antigen as affinity ligand.

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.