
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LAGE3 Antibody
상품 한눈에 보기
인간 LAGE3 단백질을 인식하는 폴리클로날 항체. IHC 및 ICC 응용에 적합. 토끼에서 생산된 IgG 항체로, PrEST 항원으로 친화 정제됨. 인간 반응성 검증 완료, 40% 글리세롤 PBS 버퍼 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA036123-100 Anti-LAGE3 Antibody, L antigen family, member 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036123-25 Anti-LAGE3 Antibody, L antigen family, member 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LAGE3 Antibody
Anti-LAGE3 Antibody
Target Information
- Target Protein: L antigen family, member 3
- Target Gene: LAGE3
- Alternative Gene Names: CVG5, DXS9879E, DXS9951E, ESO3, ITBA2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
IFTLSVPFPTPLEAEIAHGSLAPDAEPHQRVVGKDLTVSGRILVVRWKAEDCRLLRISVINFLDQLSLVVRTMQRFG
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000015289 | 71% |
| Rat | ENSRNOG00000053456 | 71% |
Product Description
Polyclonal Antibody against Human LAGE3
Clonality and Host
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



