Atlas Antibodies Anti-KRT82 Antibody

상품 한눈에 보기

Human KRT82 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. Hb-2, KRTHB2 대체 유전자명과 호환되며, 인체 시료 분석에 적합.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA058715-100 Anti-KRT82 Antibody, keratin 82 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA058715-25 Anti-KRT82 Antibody, keratin 82 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: keratin 82
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal antibody against human KRT82, validated for immunohistochemistry (IHC).

Hb-2, KRTHB2

항목	내용
Target Protein	keratin 82
Target Gene	KRT82
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	SSSKGAFLYEPCGVSTPVLSTGVLRSNGGCSIVGTGELYVPCEPQGLLSCGSGRKSSMTLGAG
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000033403 (71%), Mouse ENSMUSG00000049548 (66%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand