
Atlas Antibodies Anti-KRT82 Antibody
상품 한눈에 보기
Human KRT82 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. Hb-2, KRTHB2 대체 유전자명과 호환되며, 인체 시료 분석에 적합.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-KRT82 Antibody
Target Protein: keratin 82
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against human KRT82, validated for immunohistochemistry (IHC).
Alternative Gene Names
Hb-2, KRTHB2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | keratin 82 |
| Target Gene | KRT82 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | SSSKGAFLYEPCGVSTPVLSTGVLRSNGGCSIVGTGELYVPCEPQGLLSCGSGRKSSMTLGAG |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000033403 (71%), Mouse ENSMUSG00000049548 (66%) |
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-KRT8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KRT82 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KRT82 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KRT79 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KRTAP11-1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.