
Atlas Antibodies Anti-KRT25 Antibody
상품 한눈에 보기
인간 KRT25 단백질을 타겟으로 하는 토끼 폴리클로날 항체입니다. IHC 검증을 통해 독립적 항체로 단백질 발현을 확인할 수 있습니다. PrEST 항원으로 정제되었으며, 40% 글리세롤 및 PBS 버퍼에 보존됩니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-KRT25 Antibody
Target Protein: keratin 25
Supplier: Atlas Antibodies
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against Human KRT25.
Alternative Gene Names
KRT25A
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | keratin 25 |
| Target Gene | KRT25 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000035831 (90%), Rat ENSRNOG00000011196 (87%) |
Antigen Sequence:
TYCLLIGGDDGACKSGGYKSKDYGSGNVGSQVKDPAKAIVVKKVLEEVDQRSKILTTRLHSLEEKSQSN
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-KRT27 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KRT23 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KRT25 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KRT25 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KRT24 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.