CacheBy
Atlas Antibodies Anti-KRT25 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-KRT25 Antibody

상품 한눈에 보기

인간 KRT25 단백질을 타겟으로 하는 토끼 폴리클로날 항체입니다. IHC 검증을 통해 독립적 항체로 단백질 발현을 확인할 수 있습니다. PrEST 항원으로 정제되었으며, 40% 글리세롤 및 PBS 버퍼에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA058943-100 Anti-KRT25 Antibody, keratin 25, type I 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058943-25 Anti-KRT25 Antibody, keratin 25, type I 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-KRT25 Antibody

Anti-KRT25 Antibody

Target Protein: keratin 25
Supplier: Atlas Antibodies


Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal antibody against Human KRT25.

Alternative Gene Names

KRT25A

Open Datasheet


Target Information

항목 내용
Target Protein keratin 25
Target Gene KRT25
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000035831 (90%), Rat ENSRNOG00000011196 (87%)

Antigen Sequence:
TYCLLIGGDDGACKSGGYKSKDYGSGNVGSQVKDPAKAIVVKKVLEEVDQRSKILTTRLHSLEEKSQSN


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
Independent Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.