
Atlas Antibodies Anti-KRT222 Antibody
상품 한눈에 보기
인간 KRT222 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 실험에 적합합니다. 재조합 발현 검증 완료. 고순도 Affinity 정제 방식으로 제조되어 높은 특이성과 재현성을 제공합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-KRT222 Antibody
Target: Keratin 222
Type: Polyclonal Antibody against Human KRT222
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody raised in rabbit against human keratin 222.
Alternative Gene Names
KA21, KRT222P, MGC45562
Antigen Information
| 항목 | 내용 |
|---|---|
| Target Protein | keratin 222 |
| Target Gene | KRT222 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | MELSQLLNEIRANYEKILTRNQIETVLSTRIQLEEDISKKMDKDEEALKAAQAELKEARRQWHHLQVEIESLHA |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000035849 (93%)
- Rat ENSRNOG00000010839 (91%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-KRT24 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KRT28 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KRT222 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KRT23 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KRT222 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.