
Atlas Antibodies Anti-KRCC1 Antibody
상품 한눈에 보기
Human KRCC1 단백질을 인식하는 rabbit polyclonal 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공. Human에 대해 검증됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-KRCC1 Antibody
Target Protein: lysine-rich coiled-coil 1 (KRCC1)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human KRCC1.
Alternative Gene Names
- FLJ22333
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | lysine-rich coiled-coil 1 |
| Target Gene | KRCC1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | CFRKMKGDYLETCGYKGEVNSRPTYRMFDQRLPSETIQTYPRSCNIPQTVENRLPQWLPAHDSRLRLDSLS |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity |
|---|---|---|
| Mouse | ENSMUSG00000053012 | 68% |
| Rat | ENSRNOG00000007124 | 65% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)
Recommended Applications
- Immunohistochemistry (IHC)
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-KRIT1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KRI1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KRCC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KRCC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KRBOX4 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.