
Atlas Antibodies Anti-KLHL33 Antibody
상품 한눈에 보기
인간 KLHL33 단백질을 인식하는 고품질 폴리클로날 항체로, IHC 및 오쏘고날 검증에 적합합니다. 토끼 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간 반응성이 검증되어 신뢰성 높은 단백질 발현 분석에 활용 가능합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-KLHL33 Antibody
Target: kelch like family member 33 (KLHL33)
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human KLHL33
Open Datasheet (PDF)
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | kelch like family member 33 |
| Target Gene | KLHL33 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | VLTFAYEGVLGPASQGDVLAAAEALGAPRVKAAAQQTCERAGNAGEDVKKPSQAEELRENLRGIELLYREGVGCDLKLE |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000090799 (75%), Rat ENSRNOG00000042516 (73%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-KLHL34 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KLHL29 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KLHL33 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KLHL3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KLHL22 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.