
Atlas Antibodies Anti-KLHDC9 Antibody
Human KLHDC9 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB(재조합 발현) 검증 완료. Rabbit 호스트에서 생산되었으며, PrEST 항원으로 친화 정제됨. Human에 반응하며 높은 종간 항원 서열 유사성을 보유.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-KLHDC9 Antibody
Target: kelch domain containing 9 (KLHDC9)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot) – Recombinant expression validation using target protein overexpression
Product Description
Polyclonal antibody against human KLHDC9.
Alternative Gene Names
- KARCA1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | kelch domain containing 9 |
| Target Gene | KLHDC9 |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000045259 (81%) Rat ENSRNOG00000004022 (80%) |
Antigen Information
Antigen Sequence (Recombinant Protein Epitope Signature Tag, PrEST):
VDGRWLCVVGGWDGSRRLATVTALDTERGVWEAWTGTPGDCPPAGLSSHTCTRISDRELQVAGREGGIHTQRRYGSIYTLRLDPSARTY
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-KLHDC7A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KLHDC8B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KLHDC9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KLHDC4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KLHDC3 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|