
Atlas Antibodies Anti-KIF1C Antibody
상품 한눈에 보기
인간 KIF1C 단백질을 인식하는 토끼 폴리클로날 항체. WB 및 IHC에 적합. SAX2, SPAX2, SPG58 유전자 대체명으로도 알려짐. 친화정제 방식으로 높은 특이성과 재현성 제공. 인간에 대한 검증된 반응성.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-KIF1C Antibody
Target: kinesin family member 1C (KIF1C)
Type: Polyclonal Antibody against Human KIF1C
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody raised in rabbit against human KIF1C protein.
Alternative Gene Names
SAX2, SPAX2, SPG58
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | kinesin family member 1C |
| Target Gene | KIF1C |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000031364 (83%), Mouse ENSMUSG00000020821 (81%) |
Antigen Sequence Detail:
SGEAPTPLQPPEEVTPHPATPARRPPSPRRSHHPRRNSLDGGGRSRGAGSAQPEPQHFQPKKHNSYPQPPQPYPAQRPPGPRYPPYTTPPRMRRQRSAPDL
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Material Safety Data Sheet (Sodium Azide)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-KIF1C Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KIF20A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KIF1C Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KIF1BP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KIF1BP Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.