CacheBy
Atlas Antibodies Anti-KHDRBS1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-KHDRBS1 Antibody

상품 한눈에 보기

인간 KHDRBS1 단백질을 표적하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. siRNA 노크다운을 통한 유전적 검증 완료. 토끼 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제됨. 인간 반응성이 검증된 고품질 연구용 항체.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA056813-100 Anti-KHDRBS1 Antibody, KH domain containing, RNA binding, signal transduction associated 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056813-25 Anti-KHDRBS1 Antibody, KH domain containing, RNA binding, signal transduction associated 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-KHDRBS1 Antibody

Anti-KHDRBS1 Antibody

Target: KH domain containing, RNA binding, signal transduction associated 1
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot) – Genetic validation by siRNA knockdown
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human KHDRBS1.


Alternative Gene Names

FLJ34027, p62, Sam68

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein KH domain containing, RNA binding, signal transduction associated 1
Target Gene KHDRBS1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence YDDTYAEQSYEGYEGYYSQSQGDSEYYDYGHGEVQDSYEAYGQDDWNGTRPSLKAPPARPVKGAYR
Verified Species Reactivity Human
Interspecies Identity Mouse (97%), Rat (95%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Genetic
Genetic Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.