
Atlas Antibodies Anti-KDM5C Antibody
상품 한눈에 보기
Human KDM5C 단백질을 인식하는 토끼 폴리클로날 항체입니다. WB 및 ICC 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 40% 글리세롤 및 PBS 완충액에 보존되어 안정적입니다. 인간에 대해 검증된 반응성을 가집니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-KDM5C Antibody
Target: lysine (K)-specific demethylase 5C
Type: Polyclonal Antibody against Human KDM5C
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human KDM5C, a lysine (K)-specific demethylase 5C.
Alternative Gene Names
DXS1272E, JARID1C, MRX13, SMCX, XE169
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | lysine (K)-specific demethylase 5C |
| Target Gene | KDM5C |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | EELEPKRVRSSGPEAEEVQEEEELEEETGGEGPPAPIPTTGSPSTQENQNGLEPAEGTTSGPSAPFSTLTPRLH |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000057706 (78%), Mouse ENSMUSG00000025332 (77%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-KDM5C Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KDM7A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KDM5C Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KDM4C Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KDM4A Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.