
Atlas Antibodies Anti-KDM3B Antibody
상품 한눈에 보기
인간 KDM3B 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. siRNA knockdown으로 유전학적 검증 완료. 고순도 Affinity 정제 항체로 인간, 마우스, 랫트 반응성 확인. Glycerol 및 PBS buffer로 안정화됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-KDM3B Antibody
Lysine (K)-specific demethylase 3B
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) — Genetic validation by siRNA knockdown
- Immunocytochemistry (ICC)
Product Description
Polyclonal Antibody against Human KDM3B
Alternative Gene Names
C5orf7, JMJD1B, KIAA1082, NET22
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Lysine (K)-specific demethylase 3B |
| Target Gene | KDM3B |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | GEVDSNGSDGGEASRGPWKGGNASGEPGLDQRAKQPPSTFVPQINRNIRFATYTKENGRTLVVQDEPVGGDTPASFTPYSTATGQTPLAPEVGGAENKEAGKTLEQVGQGIVASAAVVTTASSTPNTVRISDTGLAAGTVPE |
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000038773): 93%
- Rat (ENSRNOG00000050200): 90%
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (Sodium Azide)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-KDM4D Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KDM3B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KDM3B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KDM1B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KDM4B Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.