
Atlas Antibodies Anti-KDELR2 Antibody
상품 한눈에 보기
인간 KDELR2 단백질을 인식하는 토끼 유래 폴리클로날 항체입니다. 면역조직화학(IHC) 등 다양한 연구 응용에 적합합니다. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공합니다. 40% 글리세롤/PBS 완충액에 보존제로 나트륨 아지드가 포함되어 있습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-KDELR2 Antibody
Target: KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 2
Supplier: Atlas Antibodies
Recommended Applications
면역조직화학 (IHC)
Product Description
Polyclonal Antibody against Human KDELR2
Alternative Gene Names
- ELP-1
- ERD2.2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 2 |
| Target Gene | KDELR2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (29%), Rat (28%) |
Antigen Sequence
YSRERSSVCQHKCQRPSPASVLQGARTEFLPQQRHKMLDTENQKLNSFVADSHQWLCK
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-KDELC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KDELR3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KDELR2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KDELC2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KDELC2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.