
Atlas Antibodies Anti-KCTD4 Antibody
상품 한눈에 보기
Human KCTD4 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB(재조합 발현 검증)에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 종 간 보존성을 가짐. 40% 글리세롤/PBS 완충액에 보존됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-KCTD4 Antibody
Target: potassium channel tetramerization domain containing 4
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Recombinant expression validation)
Recombinant expression validation: 검증은 표적 단백질 과발현을 통한 WB에서 수행됨.
Product Description
Polyclonal Antibody against Human KCTD4
Alternative Gene Names
- bA321C24.3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | potassium channel tetramerization domain containing 4 |
| Target Gene | KCTD4 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LNFLRNGELLLPEGFRENQLLAQEAEFFQLKGLAEEVKSRWEKEQLTPRETTFLEITDNHDRSQGLRIFCNAPDF |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000046523 (100%), Rat ENSRNOG00000050996 (99%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 맞는 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-KDELC2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KDELC2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KCTD4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KCTD19 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KDELC1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.