CacheBy
Thermo Fisher Scientific TMEM107 Polyclonal Antibody
원본

Thermo Fisher Scientific TMEM107 Polyclonal Antibody

상품 한눈에 보기

TMEM107 단백질을 인식하는 Rabbit Polyclonal 항체로, Human 시료에 반응합니다. Western blot, IHC, Flow Cytometry에 사용 가능하며, 항원 친화 크로마토그래피로 정제되었습니다. 연구용으로만 사용되며, -20°C에서 보관합니다.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오후 11:36
Thermo Fisher Scientific PA580138 TMEM107 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific TMEM107 Polyclonal Antibody

Applications and Tested Dilution

Application Tested Dilution
Western Blot (WB) 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P)) 0.5–1 µg/mL
Flow Cytometry (Flow) 1–3 µg/1×10⁶ cells

Product Specifications

Specification Description
Species Reactivity Human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human TMEM107 (22–57aa VITLFWSRDSNIQACLPLTFTPEEYDKQDIQLVAAL)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 5 mg BSA
Contains 0.05 mg sodium azide
Storage Conditions -20°C
Shipping Conditions Ambient (domestic); Wet ice (international)
RRID AB_2747252

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

Gene ontology (GO) annotation includes:

  • Embryonic digit morphogenesis
  • Neural tube patterning
  • Non-motile cilium assembly
  • Protein localization to ciliary transition zone

For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.