
Thermo Fisher Scientific TMEM107 Polyclonal Antibody
상품 한눈에 보기
TMEM107 단백질을 인식하는 Rabbit Polyclonal 항체로, Human 시료에 반응합니다. Western blot, IHC, Flow Cytometry에 사용 가능하며, 항원 친화 크로마토그래피로 정제되었습니다. 연구용으로만 사용되며, -20°C에서 보관합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human TMEM107 (22–57aa VITLFWSRDSNIQACLPLTFTPEEYDKQDIQLVAAL) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747252 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Gene ontology (GO) annotation includes:
- Embryonic digit morphogenesis
- Neural tube patterning
- Non-motile cilium assembly
- Protein localization to ciliary transition zone
For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific TNFAIP1 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific TMEM240 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific TMEM107 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific TLR8 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific TLR8 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.