Atlas Antibodies Anti-ZSWIM8 Antibody
상품 옵션 정보 | |||||||
---|---|---|---|---|---|---|---|
카탈로그 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA041244-100 | Atlas Antibodies HPA041244-100 Anti-ZSWIM8 Antibody, zinc finger, SWIM-type containing 8 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
HPA041244-25 | Atlas Antibodies HPA041244-25 Anti-ZSWIM8 Antibody, zinc finger, SWIM-type containing 8 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 |
다른 상품 둘러보기
Anti-ZSWIM8 Antibody
zinc finger, SWIM-type containing 8
Recommended Applications
Product Description
Polyclonal Antibody against Human ZSWIM8
Alternative Gene Names
4832404P21Rik, KIAA0913
Target Protein
zinc finger, SWIM-type containing 8
Target Gene
ZSWIM8
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
MELMFAEWEDGERFSFEDSDRFEEDSLCSFISEAESLCQNWRGWRKQS
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Mouse ENSMUSG00000021819 (100%)
Rat ENSRNOG00000056617 (100%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet
)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|