CacheBy
Atlas Antibodies Anti-ZSWIM1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZSWIM1 Antibody

상품 한눈에 보기

Human ZSWIM1 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC에 적합하며, PrEST 항원을 이용해 친화 정제됨. 인간에 특이적이며 마우스 및 랫트와 89% 서열 유사성 보유. 40% 글리세롤/PBS 완충액에 보존제 포함.

카탈로그번호
HPA046751-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046751-100 Anti-ZSWIM1 Antibody, zinc finger, SWIM-type containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046751-25 Anti-ZSWIM1 Antibody, zinc finger, SWIM-type containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZSWIM1 Antibody

Anti-ZSWIM1 Antibody

Target: zinc finger, SWIM-type containing 1 (ZSWIM1)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human ZSWIM1.


Alternative Gene Names

C20orf162, dJ337O18.5

Open Datasheet


Target Information

항목 내용
Target Protein zinc finger, SWIM-type containing 1
Target Gene ZSWIM1
Verified Species Reactivity Human
Interspecies Identity Mouse (89%), Rat (89%)

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:

ILAMLSARRQVLQPDMLPAQWTAGCATSLDSILGSKWSETLDKHLAVTHLTEEVGQLLQHCTKEEFERRYSTLRELADSWIGPYEQVQL

Purification Method

Affinity purified using the PrEST antigen as affinity ligand.


Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.