
Atlas Antibodies Anti-ZSWIM1 Antibody
상품 한눈에 보기
Human ZSWIM1 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC에 적합하며, PrEST 항원을 이용해 친화 정제됨. 인간에 특이적이며 마우스 및 랫트와 89% 서열 유사성 보유. 40% 글리세롤/PBS 완충액에 보존제 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ZSWIM1 Antibody
Target: zinc finger, SWIM-type containing 1 (ZSWIM1)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human ZSWIM1.
Alternative Gene Names
C20orf162, dJ337O18.5
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | zinc finger, SWIM-type containing 1 |
| Target Gene | ZSWIM1 |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (89%), Rat (89%) |
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:
ILAMLSARRQVLQPDMLPAQWTAGCATSLDSILGSKWSETLDKHLAVTHLTEEVGQLLQHCTKEEFERRYSTLRELADSWIGPYEQVQLPurification Method
Affinity purified using the PrEST antigen as affinity ligand.
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ZSWIM7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZSWIM5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZSWIM1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZSWIM3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZSWIM3 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.