CacheBy
Atlas Antibodies Anti-ZSCAN22 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZSCAN22 Antibody

상품 한눈에 보기

Human ZSCAN22 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합. PrEST 항원을 이용해 친화 정제됨. HKR2, ZNF50 대체 유전자명으로도 알려짐. 인체 반응성이 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA006471-100 Anti-ZSCAN22 Antibody, zinc finger and SCAN domain containing 22 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA006471-25 Anti-ZSCAN22 Antibody, zinc finger and SCAN domain containing 22 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZSCAN22 Antibody

Anti-ZSCAN22 Antibody

Target: zinc finger and SCAN domain containing 22 (ZSCAN22)
Type: Polyclonal Antibody against Human ZSCAN22


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

  • Polyclonal antibody raised in rabbit against human ZSCAN22 protein.
  • Alternative Gene Names: HKR2, ZNF50
  • Open Datasheet (PDF)

Target Information

항목 내용
Target Protein zinc finger and SCAN domain containing 22
Target Gene ZSCAN22
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence TQVLDKRGWDPGAEPTEASCKQSDLGESEPSNVTETLMGGVSLGPAFVKACEPEGSSERSGLSGEIWTKSVTQQIHFKKTSGPYKDVPTDQRGRESGASRNSSSAWPNLTSQ

Verified Species Reactivity

  • Human

Interspecies Information:
Highest antigen sequence identity to orthologs:

  • Mouse (ENSMUSG00000054715): 48%
  • Rat (ENSRNOG00000031113): 46%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.