AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ZSCAN22 Antibody
상품 한눈에 보기
Human ZSCAN22 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합. PrEST 항원을 이용해 친화 정제됨. HKR2, ZNF50 대체 유전자명으로도 알려짐. 인체 반응성이 검증됨.
- 카탈로그번호
- HPA006471-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA006471-100 Anti-ZSCAN22 Antibody, zinc finger and SCAN domain containing 22 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA006471-25 Anti-ZSCAN22 Antibody, zinc finger and SCAN domain containing 22 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ZSCAN22 Antibody
Anti-ZSCAN22 Antibody
Target: zinc finger and SCAN domain containing 22 (ZSCAN22)
Type: Polyclonal Antibody against Human ZSCAN22
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
- Polyclonal antibody raised in rabbit against human ZSCAN22 protein.
- Alternative Gene Names: HKR2, ZNF50
- Open Datasheet (PDF)
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | zinc finger and SCAN domain containing 22 |
| Target Gene | ZSCAN22 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | TQVLDKRGWDPGAEPTEASCKQSDLGESEPSNVTETLMGGVSLGPAFVKACEPEGSSERSGLSGEIWTKSVTQQIHFKKTSGPYKDVPTDQRGRESGASRNSSSAWPNLTSQ |
Verified Species Reactivity
- Human
Interspecies Information:
Highest antigen sequence identity to orthologs:
- Mouse (ENSMUSG00000054715): 48%
- Rat (ENSRNOG00000031113): 46%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.