
Atlas Antibodies Anti-ZSCAN22 Antibody
상품 한눈에 보기
Human ZSCAN22 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합. PrEST 항원을 이용해 친화 정제됨. HKR2, ZNF50 대체 유전자명으로도 알려짐. 인체 반응성이 검증됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ZSCAN22 Antibody
Target: zinc finger and SCAN domain containing 22 (ZSCAN22)
Type: Polyclonal Antibody against Human ZSCAN22
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
- Polyclonal antibody raised in rabbit against human ZSCAN22 protein.
- Alternative Gene Names: HKR2, ZNF50
- Open Datasheet (PDF)
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | zinc finger and SCAN domain containing 22 |
| Target Gene | ZSCAN22 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | TQVLDKRGWDPGAEPTEASCKQSDLGESEPSNVTETLMGGVSLGPAFVKACEPEGSSERSGLSGEIWTKSVTQQIHFKKTSGPYKDVPTDQRGRESGASRNSSSAWPNLTSQ |
Verified Species Reactivity
- Human
Interspecies Information:
Highest antigen sequence identity to orthologs:
- Mouse (ENSMUSG00000054715): 48%
- Rat (ENSRNOG00000031113): 46%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ZSCAN26 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZSCAN20 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZSCAN22 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZSCAN21 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZSCAN18 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.