CacheBy
Atlas Antibodies Anti-ZSCAN1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZSCAN1 Antibody

상품 한눈에 보기

인간 ZSCAN1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. IHC 및 ICC 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. PBS/glycerol 버퍼에 보존되어 있으며 인간 종에 대해 검증된 반응성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA007938-100 Anti-ZSCAN1 Antibody, zinc finger and SCAN domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA007938-25 Anti-ZSCAN1 Antibody, zinc finger and SCAN domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZSCAN1 Antibody

Anti-ZSCAN1 Antibody

Target Protein: Zinc finger and SCAN domain containing 1
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human ZSCAN1.


Alternative Gene Names

  • FLJ33779
  • ZNF915

Open Datasheet


Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

QPSLKHTKGGTQEAVAGISVVPRGPRGGRPFQCADCGMVFTWVTHFIEHQKTHREEGPFPCPECGKVFLHNSVLTEHGKIHLLEPPRKKAPRSKGPRESVPPRDGAQGPVAPRSPKRPFQCSVCGKAFPWMVHLIDHQKL

Verified Species Reactivity

  • Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000016971 (34%)
  • Mouse ENSMUSG00000068551 (33%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.