
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ZNHIT6 Antibody
상품 한눈에 보기
Human ZNHIT6 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB(재조합 발현 검증), ICC에 적합합니다. PrEST 항원을 이용한 친화정제 방식으로 제조되었으며, 높은 특이성과 재현성을 제공합니다. Human에 대해 검증됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA018132-100 Anti-ZNHIT6 Antibody, zinc finger, HIT-type containing 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018132-25 Anti-ZNHIT6 Antibody, zinc finger, HIT-type containing 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ZNHIT6 Antibody
Anti-ZNHIT6 Antibody
Target: zinc finger, HIT-type containing 6
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, recombinant expression validation using target protein overexpression)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human ZNHIT6.
Alternative Gene Names
BCD1, C1orf181, FLJ20729, NY-BR-75
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | zinc finger, HIT-type containing 6 |
| Target Gene | ZNHIT6 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | KEELMHGECVKEEKDFLKKEIVDDTKVKEEPPINHPVGCKRKLAMSRCETCGTEEAKYRCPRCMRYSCSLPCVKKHKAELTCNGVRDKTAYISIQQFTEMNLL |
Verified Species Reactivity
Human
Interspecies Information
| Species | Gene ID | Identity |
|---|---|---|
| Mouse | ENSMUSG00000074182 | 74% |
| Rat | ENSRNOG00000030049 | 72% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



