
Atlas Antibodies Anti-ZNHIT6 Antibody
상품 한눈에 보기
Human ZNHIT6 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB(재조합 발현 검증), ICC에 적합합니다. PrEST 항원을 이용한 친화정제 방식으로 제조되었으며, 높은 특이성과 재현성을 제공합니다. Human에 대해 검증됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ZNHIT6 Antibody
Target: zinc finger, HIT-type containing 6
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, recombinant expression validation using target protein overexpression)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human ZNHIT6.
Alternative Gene Names
BCD1, C1orf181, FLJ20729, NY-BR-75
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | zinc finger, HIT-type containing 6 |
| Target Gene | ZNHIT6 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | KEELMHGECVKEEKDFLKKEIVDDTKVKEEPPINHPVGCKRKLAMSRCETCGTEEAKYRCPRCMRYSCSLPCVKKHKAELTCNGVRDKTAYISIQQFTEMNLL |
Verified Species Reactivity
Human
Interspecies Information
| Species | Gene ID | Identity |
|---|---|---|
| Mouse | ENSMUSG00000074182 | 74% |
| Rat | ENSRNOG00000030049 | 72% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ZNRF1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNRD1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNHIT6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNHIT3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF891 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.