
Atlas Antibodies Anti-KCNH3 Antibody
Human KCNH3 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC에 적합합니다. 높은 종간 보존성(인간-쥐 96%, 인간-랫 95%)을 가지며, PrEST 항원을 이용해 친화정제되었습니다. 신뢰성 높은 전압개폐성 칼륨 채널 연구용 시약입니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-KCNH3 Antibody
Target: potassium voltage-gated channel, subfamily H (eag-related), member 3
Type: Polyclonal Antibody against Human KCNH3
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human KCNH3 protein.
Alternative Gene Names
BEC1, ELK2, Kv12.2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | potassium voltage-gated channel, subfamily H (eag-related), member 3 |
| Target Gene | KCNH3 |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (96%), Rat (95%) |
Antigen Information
Antigen Sequence (PrEST):
EVDTSSLSGDNTLMSTLEEKETDGEQGPTVSPAPADEPSSPLLSPGCTSSSSAAKLLSPRRTAPRPRLGGRGRPGRAGALK
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and experimental conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-KCNH6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KCNH5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KCNH3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KCNH5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KCNH1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|