
Atlas Antibodies Anti-KCNG1 Antibody
상품 한눈에 보기
KCNG1 단백질을 인식하는 토끼 폴리클로날 항체로, 인간, 마우스, 랫트에 반응합니다. IHC, WB, ICC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. 40% 글리세롤 및 PBS 완충액에 보존되어 안정적입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-KCNG1 Antibody
Target: Potassium voltage-gated channel, subfamily G, member 1 (KCNG1)
Type: Polyclonal Antibody against Human KCNG1
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
This polyclonal antibody targets the human KCNG1 protein, a potassium voltage-gated channel subfamily member. It is affinity purified using the PrEST antigen as affinity ligand.
Alternative Gene Names
K13, KCNG, kH2, Kv6.1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Potassium voltage-gated channel, subfamily G, member 1 |
| Target Gene | KCNG1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFY |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Rat ENSRNOG00000054314 (90%) Mouse ENSMUSG00000074575 (88%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer Composition | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-KCNH1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KCNG2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KCNG1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KCNG1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KCNF1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.