
Atlas Antibodies Anti-KCNF1 Antibody
상품 한눈에 보기
인간 KCNF1 단백질을 인식하는 폴리클로날 항체로, 전압 개폐성 칼륨 채널 연구에 적합합니다. Rabbit 유래 IgG이며, PrEST 항원으로 친화 정제되었습니다. 인간에 반응하며, 높은 종간 항원 서열 유사성을 보입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-KCNF1 Antibody
Target: Potassium voltage-gated channel, subfamily F, member 1 (KCNF1)
Type: Polyclonal Antibody against Human KCNF1
Supplier: Atlas Antibodies
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody targeting the human KCNF1 protein, a member of the voltage-gated potassium channel family.
Alternative Gene Names
IK8, KCNF, kH1, Kv5.1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Potassium voltage-gated channel, subfamily F, member 1 |
| Target Gene | KCNF1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | VRYYNKQRVLETAAKHELELMELNSSSGGEGKTGGSRSDLDNLPPEPAGKEAPSCSSRLKLSHSDTFIPLLTEEKHHRTRLQSCK |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000051726 | 89% |
| Rat | ENSRNOG00000024310 | 88% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-KCNG1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KCNG1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KCNF1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KCNF1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-KCNE5 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.