
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ITGB2 Antibody
상품 한눈에 보기
인간 ITGB2 단백질을 인식하는 폴리클로날 토끼 항체. IHC 및 WB에서 검증된 고품질 항체로, 독립적 및 직교적 검증을 통해 신뢰성 확보. CD18, LFA-1 등 대체 유전자명으로도 알려짐. PrEST 항원으로 친화 정제됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA016894-100 Anti-ITGB2 Antibody, integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA016894-25 Anti-ITGB2 Antibody, integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ITGB2 Antibody
Anti-ITGB2 Antibody
Target: integrin, beta 2 (complement component 3 receptor 3 and 4 subunit)
Supplier: Atlas Antibodies
Recommended Applications
- Orthogonal validation (IHC): Protein expression verified by comparison to RNA-seq data in tissues with high and low expression levels.
- Independent antibody validation (WB): Protein expression confirmed by comparing independent antibodies targeting different epitopes of the same protein.
Product Description
Polyclonal antibody against human ITGB2.
Alternative Gene Names: CD18, LFA-1, MAC-1, MFI7
Open Datasheet (PDF)
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) |
| Target Gene | ITGB2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | CTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSML |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse: 83% (ENSMUSG00000000290), Rat: 78% (ENSRNOG00000001224) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2) containing 0.02% sodium azide as preservative. Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



