
Atlas Antibodies Anti-ITGB2 Antibody
상품 한눈에 보기
인간 ITGB2 단백질을 인식하는 폴리클로날 토끼 항체. IHC 및 WB에서 검증된 고품질 항체로, 독립적 및 직교적 검증을 통해 신뢰성 확보. CD18, LFA-1 등 대체 유전자명으로도 알려짐. PrEST 항원으로 친화 정제됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ITGB2 Antibody
Target: integrin, beta 2 (complement component 3 receptor 3 and 4 subunit)
Supplier: Atlas Antibodies
Recommended Applications
- Orthogonal validation (IHC): Protein expression verified by comparison to RNA-seq data in tissues with high and low expression levels.
- Independent antibody validation (WB): Protein expression confirmed by comparing independent antibodies targeting different epitopes of the same protein.
Product Description
Polyclonal antibody against human ITGB2.
Alternative Gene Names: CD18, LFA-1, MAC-1, MFI7
Open Datasheet (PDF)
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) |
| Target Gene | ITGB2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | CTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSML |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse: 83% (ENSMUSG00000000290), Rat: 78% (ENSRNOG00000001224) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2) containing 0.02% sodium azide as preservative. Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ITGB4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ITGB3BP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ITGB2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ITGB3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ITGB2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.