CacheBy
Atlas Antibodies Anti-ITGB2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ITGB2 Antibody

상품 한눈에 보기

인간 ITGB2 단백질을 인식하는 폴리클로날 토끼 항체. IHC 및 WB에서 검증된 고품질 항체로, 독립적 및 직교적 검증을 통해 신뢰성 확보. CD18, LFA-1 등 대체 유전자명으로도 알려짐. PrEST 항원으로 친화 정제됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA016894-100 Anti-ITGB2 Antibody, integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA016894-25 Anti-ITGB2 Antibody, integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ITGB2 Antibody

Anti-ITGB2 Antibody

Target: integrin, beta 2 (complement component 3 receptor 3 and 4 subunit)
Supplier: Atlas Antibodies


  • Orthogonal validation (IHC): Protein expression verified by comparison to RNA-seq data in tissues with high and low expression levels.
  • Independent antibody validation (WB): Protein expression confirmed by comparing independent antibodies targeting different epitopes of the same protein.

Product Description

Polyclonal antibody against human ITGB2.

Alternative Gene Names: CD18, LFA-1, MAC-1, MFI7
Open Datasheet (PDF)


Target Information

항목 내용
Target Protein integrin, beta 2 (complement component 3 receptor 3 and 4 subunit)
Target Gene ITGB2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence CTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSML
Verified Species Reactivity Human
Interspecies Identity Mouse: 83% (ENSMUSG00000000290), Rat: 78% (ENSRNOG00000001224)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2) containing 0.02% sodium azide as preservative. Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB Independent
Independent Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.