
Atlas Antibodies Anti-ITFG2 Antibody
상품 한눈에 보기
Human ITFG2 단백질을 표적으로 하는 폴리클로날 항체로, IHC, WB(재조합 발현 검증), ICC 실험에 적합합니다. Rabbit에서 생산된 IgG 항체이며, 프레스티지 항원 기반 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ITFG2 Antibody
Target: integrin alpha FG-GAP repeat containing 2
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) – Recombinant expression validation using target protein overexpression
- Immunocytochemistry (ICC)
Product Description
Polyclonal Antibody against Human ITFG2
Alternative Gene Names
- MDS028
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | integrin alpha FG-GAP repeat containing 2 |
| Target Gene | ITFG2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000006264 (84%), Mouse ENSMUSG00000001518 (82%) |
Antigen Sequence
AILLCTWKKDTGSPPASEGPTDGSRETPAARDVVLHQTSGRIHNKNVSTHLIGNIKQGHGTESSGSGLFALCTLDGTLKLMEEMEEADKLLWSV
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ITGA2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ITGA2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ITFG2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ITFG2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ITFG1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.