CacheBy
Atlas Antibodies Anti-IRF2BPL Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IRF2BPL Antibody

상품 한눈에 보기

Human IRF2BPL 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합. Orthogonal validation으로 RNA-seq 데이터와 단백질 발현 비교 검증 완료. 고순도의 Affinity purified 제품으로 높은 특이성과 재현성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA050862-100 Anti-IRF2BPL Antibody, interferon regulatory factor 2 binding protein-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050862-25 Anti-IRF2BPL Antibody, interferon regulatory factor 2 binding protein-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IRF2BPL Antibody

Anti-IRF2BPL Antibody

interferon regulatory factor 2 binding protein-like

  • IHC (Immunohistochemistry)
  • WB (Western Blot, Orthogonal validation)
  • ICC (Immunocytochemistry)

Orthogonal validation:
Protein expression validated using WB by comparison to RNA-seq data of the corresponding target in high and low expression cell lines.

Product Description

Polyclonal Antibody against Human IRF2BPL

Alternative Gene Names

C14orf4, EAP1, KIAA1865

Open Datasheet

Target Information

항목 내용
Target Protein interferon regulatory factor 2 binding protein-like
Target Gene IRF2BPL
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence SSSVAEVGVGAGGKRPGSVSSTDQERELKEKQRNAEALAELSESLRNRAEEWASKPKMVRDTLLTLAGCTPYEVRFKKD
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000011026 (96%), Mouse ENSMUSG00000034168 (96%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Orthogonal
Orthogonal Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.