
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-IRF2BPL Antibody
상품 한눈에 보기
인간 IRF2BPL 단백질에 대한 고특이성 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Orthogonal validation을 통해 단백질 발현 검증이 수행되었습니다. 토끼 유래 IgG 항체이며, 친화 정제 방식으로 높은 순도 확보.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA061333-100 Anti-IRF2BPL Antibody, interferon regulatory factor 2 binding protein-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061333-25 Anti-IRF2BPL Antibody, interferon regulatory factor 2 binding protein-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-IRF2BPL Antibody
Anti-IRF2BPL Antibody
Target: interferon regulatory factor 2 binding protein-like
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot) – Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines
- ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human IRF2BPL
Alternative Gene Names
- C14orf4
- EAP1
- KIAA1865
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | interferon regulatory factor 2 binding protein-like |
| Target Gene | IRF2BPL |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Antigen Sequence Detail | SSSVAEVGVGAGGKRPGSVSSTDQERELKEKQRNAEALAELSESLRNRAEEWASKPKMVRDTLLTLAGCTPYEVRFKKD |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000034168 (96%)
- Rat ENSRNOG00000011026 (96%)
Antibody Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



