CacheBy
Atlas Antibodies Anti-IRF2BPL Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IRF2BPL Antibody

상품 한눈에 보기

인간 IRF2BPL 단백질에 대한 고특이성 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Orthogonal validation을 통해 단백질 발현 검증이 수행되었습니다. 토끼 유래 IgG 항체이며, 친화 정제 방식으로 높은 순도 확보.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA061333-100 Anti-IRF2BPL Antibody, interferon regulatory factor 2 binding protein-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061333-25 Anti-IRF2BPL Antibody, interferon regulatory factor 2 binding protein-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IRF2BPL Antibody

Anti-IRF2BPL Antibody

Target: interferon regulatory factor 2 binding protein-like
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot) – Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human IRF2BPL


Alternative Gene Names

  • C14orf4
  • EAP1
  • KIAA1865

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein interferon regulatory factor 2 binding protein-like
Target Gene IRF2BPL
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence Detail SSSVAEVGVGAGGKRPGSVSSTDQERELKEKQRNAEALAELSESLRNRAEEWASKPKMVRDTLLTLAGCTPYEVRFKKD

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000034168 (96%)
  • Rat ENSRNOG00000011026 (96%)

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Orthogonal Validation
Orthogonal Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.