AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-IRF2BP2 Antibody
상품 한눈에 보기
Human IRF2BP2 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합함. Rabbit 유래 IgG 항체이며, PrEST 항원으로 정제됨. Human, Mouse, Rat에서 반응 확인됨. 안정적 PBS/glycerol 버퍼에 보존.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA062269-100 Anti-IRF2BP2 Antibody, interferon regulatory factor 2 binding protein 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062269-25 Anti-IRF2BP2 Antibody, interferon regulatory factor 2 binding protein 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-IRF2BP2 Antibody
Anti-IRF2BP2 Antibody
Target Information
- Protein: Interferon Regulatory Factor 2 Binding Protein 2
- Gene: IRF2BP2
- Alternative Gene Names: IRF-2BP2
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal Antibody against Human IRF2BP2.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
QDWVNRPKTVRDTLLALHQHGHSGPFESKFKKEPALTAGRLLGFEANGANGSKAVARTARKRKPSPEPEGEVG
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000051495 | 96% |
| Rat | ENSRNOG00000049900 | 95% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.