CacheBy
Atlas Antibodies Anti-IRF2BP2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IRF2BP2 Antibody

상품 한눈에 보기

Human IRF2BP2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 실험에 적합. Human, Mouse, Rat에 반응하며 PrEST 항원으로 정제됨. 40% glycerol/PBS buffer에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027815-100 Anti-IRF2BP2 Antibody, interferon regulatory factor 2 binding protein 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027815-25 Anti-IRF2BP2 Antibody, interferon regulatory factor 2 binding protein 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IRF2BP2 Antibody

Anti-IRF2BP2 Antibody

Target: Interferon regulatory factor 2 binding protein 2 (IRF2BP2)

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human IRF2BP2.

Alternative Gene Names

  • IRF-2BP2

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Interferon regulatory factor 2 binding protein 2
Target Gene IRF2BP2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence QDWVNRPKTVRDTLLALHQHGHSGPFESKFKKEPALTAGRLLGFEANGANGSKAVARTARKRKPSPEPEGEVG

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

Ortholog ID Sequence Identity
Mouse ENSMUSG00000051495 96%
Rat ENSRNOG00000049900 95%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.