Atlas Antibodies Anti-IL27RA Antibody

상품 한눈에 보기

Human IL27RA를 인식하는 rabbit polyclonal antibody로, interleukin 27 receptor subunit alpha 검출에 적합. PrEST 항원을 이용해 affinity purification 수행. ICC 등 다양한 응용 가능. Human 종에 대해 검증됨.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA073441-100 Anti-IL27RA Antibody, interleukin 27 receptor subunit alpha 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA073441-25 Anti-IL27RA Antibody, interleukin 27 receptor subunit alpha 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-IL27RA Antibody

Anti-IL27RA Antibody

Target Information

Protein: Interleukin 27 receptor subunit alpha
Gene: IL27RA
Alternative Gene Names: CRL1, IL-27R, TCCR, WSX-1, WSX1, zcytor1

Recommended Applications

면역세포화학(ICC) 등 다양한 연구 응용에 적합합니다.

Product Description

Polyclonal antibody against human IL27RA.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

QCYGVGPLGDLNCSWEPLGDLGAPSELHLQSQKYRSNKTQTVAVAAGRSWVAIPREQLTMSDKLLVWGTKAGQPLWPPVFVNL

Verified Species Reactivity

Human

Interspecies Information

Species	Gene ID	Sequence Identity
Rat	ENSRNOG00000005747	65%
Mouse	ENSMUSG00000005465	65%

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand