
Atlas Antibodies Anti-ZNF786 Antibody
휴먼 ZNF786 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. 인간에 특이적으로 반응하며, 40% 글리세롤 PBS 버퍼에 보존됨.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ZNF786 Antibody
Target: Zinc finger protein 786 (ZNF786)
Type: Polyclonal Antibody against Human ZNF786
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody raised in rabbit against human ZNF786.
Alternative Gene Name: DKFZp762I137
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Zinc finger protein 786 |
| Target Gene | ZNF786 |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000051499 (45%), Rat ENSRNOG00000006925 (40%) |
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
EGIPGPRNLDLPGLWDVPAWESTQHPWPVCGESCWENNHLVMHQRGHSKDRTRRAWEKFNKRAETQMPWSSPRVQRH
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ZNF8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF789 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF786 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF790 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF790 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|