
Atlas Antibodies Anti-ZNF740 Antibody
상품 한눈에 보기
Human ZNF740 단백질을 인식하는 폴리클로날 항체로, IHC, WB(재조합 발현 검증), ICC에 적합. Rabbit 호스트에서 생산되며, PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ZNF740 Antibody
Target: zinc finger protein 740 (ZNF740)
Type: Polyclonal Antibody against Human ZNF740
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Recombinant Expression Validation)
- ICC (Immunocytochemistry)
Recombinant expression validation:
Validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against human ZNF740, validated for multiple applications.
Alternative Gene Names
- Zfp740
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | zinc finger protein 740 |
| Target Gene | ZNF740 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | AQASLLACEGLAGVSLVPTAASKKMMLSQIASKQAENGERAGSPDVLRCSSQGHRKDSDKSRSRKDD |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (97%), Rat (84%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 설명 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ZNF720 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF736 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF740 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF74 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF721 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.