
Atlas Antibodies Anti-ZNF594 Antibody
상품 한눈에 보기
Human ZNF594 단백질을 인식하는 토끼 폴리클로날 항체로, zinc finger protein 594 연구용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 제조. 인간 반응성이 검증되었으며, 다양한 응용에 사용 가능.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ZNF594 Antibody
Target: zinc finger protein 594
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human ZNF594, suitable for research applications involving zinc finger protein 594.
Alternative Gene Names
- KIAA1871
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | zinc finger protein 594 |
| Target Gene | ZNF594 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | IREMHIIPQKAIVGEIGHGCNEGEKILSAGESSHRYEVSGQNFKQKSGLTEHQK |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000053297 (33%), Rat ENSRNOG00000053518 (31%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Recommended Applications
ICC (Immunocytochemistry)
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ZNF596 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF594 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF594 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF592 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF594 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.