
Atlas Antibodies Anti-ZNF584 Antibody
상품 한눈에 보기
인간 ZNF584(zinc finger protein 584)에 특이적인 폴리클로날 항체. Rabbit 유래 IgG로, IHC 및 ICC에 적합. PrEST 항원으로 친화 정제되었으며, PBS/glycerol buffer에 보존. Human에 반응성 검증됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ZNF584 Antibody
Target: zinc finger protein 584 (ZNF584)
Type: Polyclonal Antibody against Human ZNF584
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human zinc finger protein 584 (ZNF584).
Alternative Gene Names
- FLJ39899
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | zinc finger protein 584 |
| Target Gene | ZNF584 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | LVSSLGLAPSRSPVFTQLEDDEQSWVPSWVDVTPVSRAEARRGFGLDGLCRVEDERAHP |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | Ortholog ID | 항원 서열 동일성 |
|---|---|---|
| Rat | ENSRNOG00000050651 | 32% |
| Mouse | ENSMUSG00000031907 | 29% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Related Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ZNF583 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF583 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF584 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF580 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF581 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.