
Atlas Antibodies Anti-ZNF518B Antibody
상품 한눈에 보기
Human ZNF518B 인식 폴리클로날 항체로, Rabbit에서 생산된 IgG 형 항체입니다. 면역조직화학(IHC)에 적합하며, PrEST 항원으로 친화 정제되었습니다. Human에 특이적으로 반응하며 glycerol 및 PBS buffer에 보존됩니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ZNF518B Antibody
Target Information
- Target Protein: Zinc finger protein 518B
- Target Gene: ZNF518B
- Alternative Gene Names: KIAA1729
Product Description
Polyclonal antibody against human ZNF518B.
Antigen Information
- Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
AKCKSVHKISLQDLQKGTGKDGMYVCFQCSLGAAPPNFHFVSNNSSATHVGNKTENFSSSVNSKFKVRNFKPGKYYCDKCRF
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000046572): 67%
- Rat (ENSRNOG00000028534): 65%
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer Composition | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Safety Information | Material Safety Data Sheet |
Recommended Applications
- Immunohistochemistry (IHC)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ZNF524 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF521 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF518B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF519 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF518A Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.