CacheBy
Atlas Antibodies Anti-ZNF518B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZNF518B Antibody

상품 한눈에 보기

Human ZNF518B 인식 폴리클로날 항체로, Rabbit에서 생산된 IgG 형 항체입니다. 면역조직화학(IHC)에 적합하며, PrEST 항원으로 친화 정제되었습니다. Human에 특이적으로 반응하며 glycerol 및 PBS buffer에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA031216-100 Anti-ZNF518B Antibody, zinc finger protein 518B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031216-25 Anti-ZNF518B Antibody, zinc finger protein 518B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZNF518B Antibody

Anti-ZNF518B Antibody

Target Information

  • Target Protein: Zinc finger protein 518B
  • Target Gene: ZNF518B
  • Alternative Gene Names: KIAA1729

Product Description

Polyclonal antibody against human ZNF518B.

Antigen Information

  • Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    AKCKSVHKISLQDLQKGTGKDGMYVCFQCSLGAAPPNFHFVSNNSSATHVGNKTENFSSSVNSKFKVRNFKPGKYYCDKCRF

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000046572): 67%
  • Rat (ENSRNOG00000028534): 65%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Safety Information Material Safety Data Sheet
  • Immunohistochemistry (IHC)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.