
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ZNF518B Antibody
상품 한눈에 보기
Human ZNF518B 인식 폴리클로날 항체로, Rabbit에서 생산된 IgG 형 항체입니다. 면역조직화학(IHC)에 적합하며, PrEST 항원으로 친화 정제되었습니다. Human에 특이적으로 반응하며 glycerol 및 PBS buffer에 보존됩니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA031216-100 Anti-ZNF518B Antibody, zinc finger protein 518B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031216-25 Anti-ZNF518B Antibody, zinc finger protein 518B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ZNF518B Antibody
Anti-ZNF518B Antibody
Target Information
- Target Protein: Zinc finger protein 518B
- Target Gene: ZNF518B
- Alternative Gene Names: KIAA1729
Product Description
Polyclonal antibody against human ZNF518B.
Antigen Information
- Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
AKCKSVHKISLQDLQKGTGKDGMYVCFQCSLGAAPPNFHFVSNNSSATHVGNKTENFSSSVNSKFKVRNFKPGKYYCDKCRF
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000046572): 67%
- Rat (ENSRNOG00000028534): 65%
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer Composition | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Safety Information | Material Safety Data Sheet |
Recommended Applications
- Immunohistochemistry (IHC)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



