CacheBy
Atlas Antibodies Anti-ZNF500 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZNF500 Antibody

상품 한눈에 보기

Human ZNF500 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 대한 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA057963-100 Anti-ZNF500 Antibody, zinc finger protein 500 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057963-25 Anti-ZNF500 Antibody, zinc finger protein 500 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZNF500 Antibody

Anti-ZNF500 Antibody

Target: zinc finger protein 500 (ZNF500)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human ZNF500 (zinc finger protein 500).

Alternative Gene Names

KIAA0557, ZKSCAN18, ZSCAN50

Open Datasheet (PDF)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

RKPRKHRQRGSELLSDDEVPLGIGGQFLKHQAEAQPEDLSLEEEARFSSQQPPAQLSHRPQRGPLLWPERGPPAPRHQ

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000027333 30%
Rat ENSRNOG00000000852 27%

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet

Purification Method

Affinity purified using the PrEST antigen as affinity ligand.

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.